- IL-7 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-83111
- 0.1 ml (also 25ul)
- This antibody was developed against Recombinant Protein corresponding to amino acids: VSEGTTILLN CTGQVKGRKP AALGEAQPTK SLEENKSLKE QKKLNDLCFL KRLLQEI
- IL-7
- Human
- PBS (pH 7.2) and 40% Glycerol
- IL-7
- Rabbit
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- interleukin 7
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Cell Cycle and Replication, Cytokine Research, Hematopoietic Stem Cell Markers, Immunology, Innate Immunity, Stem Cell Markers
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
VSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEI
Specifications/Features
Available conjugates: Unconjugated